DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and C1orf226

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001128712.1 Gene:C1orf226 / 400793 HGNCID:34351 Length:315 Species:Homo sapiens


Alignment Length:265 Identity:61/265 - (23%)
Similarity:92/265 - (34%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VDH---EPKMRQVEDDELGDGLKVTLSSDGSLDTNDSFNSHRHHPLNHQDAIGGFLGMDTSGLGG 128
            |.|   ||..|.| |..:.:.|...|:.  .|..:.|| .|...|:..        |....|.|.
Human    28 VSHLLSEPLSRTV-DHGMFENLNTALTP--KLQASRSF-PHLSKPVAP--------GSAPLGSGE 80

  Fly   129 NSAP-VTIGASTDLLAPNTAATRRRRKLPEIPKNKKSSILHLLGGSNFGSLADEFRNGGGGGIPP 192
            ...| :.:|:|..|   .........|:.:..:.|:.|.|..:|.:.....|......|....|.
Human    81 PGGPGLWVGSSQHL---KNLGKAMGAKVNDFLRRKEPSSLGSVGVTEINKTAGAQLASGTDAAPE 142

  Fly   193 A----VRSGQQRSFLSLKCGYLMDEDSSPDSERMQS-----------------LGDVDSGHSTAH 236
            |    .||..|.:|..|        |..|...|.::                 |..::.|  |..
Human   143 AWLEDERSVLQETFPRL--------DPPPPITRKRTPRALKTTQDMLISSQPVLSSLEYG--TEP 197

  Fly   237 SPNDFKSMSPQITSPVSQSPFPPPFGGVPFGQLEMLEATHRGLHKFVPRHHDEIELEIGDAIYVQ 301
            ||.     ..|.::|.:| |..|.....|...:|..|   ||  |.:|  :.|:.|.:.|.|:  
Human   198 SPG-----QAQDSAPTAQ-PDVPADASQPEATMEREE---RG--KVLP--NGEVSLSVPDLIH-- 247

  Fly   302 KEAED 306
            |:::|
Human   248 KDSQD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735 10/32 (31%)
PTB_JIP 343..490 CDD:269923
C1orf226NP_001128712.1 DUF4628 44..315 CDD:292069 54/248 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.