DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and CG14968

DIOPT Version :10

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster


Alignment Length:141 Identity:32/141 - (22%)
Similarity:52/141 - (36%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 YLGSVETLAHKGTGVVCQAVRKIVGEYGNSPTGQ---TCILEVSDQGLRMVDRSGPNQNKKDKKP 412
            |:||.......|.....:.|..:||...|.|..:   .|.|:||..|:::...|        .|.
  Fly    28 YIGSEVARGLWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELKVSTDGVQLEIIS--------PKA 84

  Fly   413 CIDYF-YSLKNVSFCAFHPRDHRFIGFI------TKHPTVQRFACHVF--KGSESTRPVAEAVGR 468
            .|::: |.:..:|:........|....|      :.||    |..|.|  ......|.:..|:..
  Fly    85 SINHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHP----FEVHAFVCDSRAMARKLTFALAA 145

  Fly   469 AFQRFYQKFIE 479
            |||.:.::..|
  Fly   146 AFQDYSRRVKE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 32/141 (23%)
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 28/130 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.