DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and ced-6

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster


Alignment Length:216 Identity:49/216 - (22%)
Similarity:81/216 - (37%) Gaps:64/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 GDAIYVQKEAEDLWCEGVNLRTGRQGIFPSAYAVDLDYNEFDPTVQLVKKERYLLGYLGSVETLA 359
            |||....|..:..|     |.|..|.|  |.:||                  ||:.:.|::....
  Fly    78 GDAKSEAKNGKRNW-----LHTPEQLI--SGHAV------------------YLVKFFGNLSVDQ 117

  Fly   360 HKGTGVVCQAVRKI-------VGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCIDYF 417
            .||..||.:|:||:       ..|.|.....:...:.:|.:|:.:.:   |..:|      |.:.
  Fly   118 PKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGVAIQE---PRTHK------ILHQ 173

  Fly   418 YSLKNVSFCAFHPRDHRFIGFITK--------HPTVQRFA---------------CHVFKGSEST 459
            :.|.|:|:||......:|..||.|        .||....|               |.||..::..
  Fly   174 FPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLA 238

  Fly   460 RPVAEAVGRAFQRFYQKFIET 480
            ..:...:|:||...|:|::::
  Fly   239 SDITLTIGQAFDLAYRKYMDS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735 11/33 (33%)
PTB_JIP 343..490 CDD:269923 37/168 (22%)
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 44/197 (22%)
AceK 233..>304 CDD:295079 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.