DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and Gulp1

DIOPT Version :10

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_017451882.1 Gene:Gulp1 / 314543 RGDID:1306380 Length:312 Species:Rattus norvegicus


Alignment Length:138 Identity:41/138 - (29%)
Similarity:63/138 - (45%) Gaps:13/138 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 YLLGYLGSVETLAHKGTGVVCQAVRKI-VGEYGNSPTGQ---TCILEVSDQGLRMVDRSGPNQNK 407
            |...:|||.|....|||.||..||||: ...:.....||   ...|::|..|:::::       .
  Rat    27 YNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILE-------P 84

  Fly   408 KDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSESTRPVAEAVGRAFQR 472
            |.|:  :.:...|..:||||....|.|...||.|.....:..|.||...:....:...:|:||..
  Rat    85 KTKE--VQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCFVFDSEKCAEEITLTIGQAFDL 147

  Fly   473 FYQKFIET 480
            .|:||:|:
  Rat   148 AYRKFLES 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 41/138 (30%)
Gulp1XP_017451882.1 PTB_CED-6 14..157 CDD:269971 41/138 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.