DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and Dab1

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_017448664.1 Gene:Dab1 / 266729 RGDID:628770 Length:588 Species:Rattus norvegicus


Alignment Length:134 Identity:28/134 - (20%)
Similarity:53/134 - (39%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 RYLLGYLGSVETLAHKGTGVVCQAVRK----IVGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQN 406
            ||....:|..|..|.:|..:...::.|    :.|........|...|.:|..|:::.|       
  Rat    41 RYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFD------- 98

  Fly   407 KKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSESTRPVAEAVGRAFQ 471
              :|...:.:.:::..:|:.|....|||..|::.......||.  ..|.:::..||...:...||
  Rat    99 --EKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFV--AIKTAQAAEPVILDLRDLFQ 159

  Fly   472 RFYQ 475
            ..|:
  Rat   160 LIYE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 28/134 (21%)
Dab1XP_017448664.1 PTB_Dab 25..174 CDD:269926 28/134 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.