DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and LOC100361087

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001177388.1 Gene:LOC100361087 / 100361087 RGDID:2320873 Length:292 Species:Rattus norvegicus


Alignment Length:260 Identity:61/260 - (23%)
Similarity:87/260 - (33%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EPKMRQVEDDELGDGLKVTLSSDGSLDTNDSFNSHRHHPLNHQDAIGGFLGMDTSGLGGNSAP-V 133
            ||..|.| |..:.:.|..||:.  .|.::.|| .|...|        |..|..|.|.|....| :
  Rat    13 EPFSRTV-DHSMFENLNTTLTP--KLQSSHSF-PHLSRP--------GAPGTITPGSGEPGGPGL 65

  Fly   134 TIGASTDL--LAPNTAATRRRRKLPEIPKNKKSSILHLLGGSNFGSLADEFRNGGGGGI------ 190
            .:|:|..|  |.....|     |:.::.:.|:||.|..:|.......|:....||....      
  Rat    66 RVGSSQHLRNLGKAVGA-----KVNDLLRRKESSSLGSVGVMEINKTAEAQMPGGEDAACGPWLE 125

  Fly   191 ---------------PPAVRSGQQRSFLSLKCGYLMDEDSSPDSERMQSLGDVDSGHSTAHSPND 240
                           ||..|   :|:..:||....|...|.|....::        :.|..||..
  Rat   126 DERSVQEAFPLLDPPPPITR---KRTPRALKTTQDMLISSQPVLSNLE--------YGTELSPGQ 179

  Fly   241 FKSMSPQITSPVSQSPFPPPFGGVPFGQLEMLEATHRGLHKFVPRHHDEIELEIGDAIYVQKEAE 305
            .:. ||....|||.....|.   ...|..|..||...|          |:.|.:.|.|:...:.|
  Rat   180 AQD-SPPTAQPVSADTSRPE---STTGMGEKGEALPNG----------EVSLLVPDLIHKNSQEE 230

  Fly   306  305
              Rat   231  230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735 6/31 (19%)
PTB_JIP 343..490 CDD:269923
LOC100361087NP_001177388.1 DUF4628 23..292 CDD:292069 56/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.