DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and Ldlrap1

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_663529.2 Gene:Ldlrap1 / 100017 MGIID:2140175 Length:308 Species:Mus musculus


Alignment Length:154 Identity:38/154 - (24%)
Similarity:65/154 - (42%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 LDYNEFDPTVQLVKKERYLLGYLGSVETLAHKGTGVVCQAVRKIVG-EYGNSPTGQTCILEVSDQ 393
            |..|..|....|::...:.|.|||.......||..:...||::||. ...:....|...|:||.:
Mouse    30 LPENWTDTRETLLEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPR 94

  Fly   394 GLRMVDRSGPNQNKKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSES 458
            |:.:.| |..:|..::        .|:..:|:|.......:...:|.:....:...||.|..:: 
Mouse    95 GIILTD-SLTSQLIEN--------VSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTK- 149

  Fly   459 TRPVAEA----VGRAFQ---RFYQ 475
             |.||:|    |.:||:   .|:|
Mouse   150 -RKVAQAVTLTVAQAFKVAFEFWQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 34/141 (24%)
Ldlrap1NP_663529.2 PTB_LDLRAP-mammal-like 43..165 CDD:269981 31/132 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..201
Clathrin box. /evidence=ECO:0000250|UniProtKB:Q5SW96 211..215
AP-2 complex binding. /evidence=ECO:0000250|UniProtKB:Q5SW96 248..275
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000250|UniProtKB:Q5SW96 256..265
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..308
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.