DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and SPSB4

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_543138.1 Gene:SPSB4 / 92369 HGNCID:30630 Length:273 Species:Homo sapiens


Alignment Length:286 Identity:80/286 - (27%)
Similarity:125/286 - (43%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AIAPRRRRPTGRRGGVTGGLSSGSLDASSSTSPPPRFCPLPNGVEDNWTWSKRHRSKEVVLRGPN 82
            |:.|.:|...|...|....|.. .||..::..          .|:....|:...||..|.::..:
Human    18 ALRPAKRELRGAEPGRPARLDQ-LLDMPAAGL----------AVQLRHAWNPEDRSLNVFVKDDD 71

  Fly    83 SRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFRNMLGE 147
            ..|.|.|| .::.|.|::||.....|.|.|:::...|..||..:.|:.|..|.||:..:..::|.
Human    72 RLTFHRHP-VAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGS 135

  Fly   148 NEHGWGLS-HKGVLWHEGVALLYTKRFRENQ-----------------PTQIGVLFDGIEGTLTF 194
            :...||.. .:..|:|:|          :||                 |..:.|:.|..||||:|
Human   136 DAESWGWDLGRSRLYHDG----------KNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSF 190

  Fly   195 YKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVN--------LQDRCRAVIMRR 251
            ..||:.||||||||.  .:.|||:|.:.....|:|::     ::|        |.|.||    |.
Human   191 IVDGQYLGVAFRGLK--GKKLYPVVSAVWGHCEVTMR-----YINGLDPEPLPLMDLCR----RS 244

  Fly   252 VRSAAQLEKLK----LPLP--IADYL 271
            :|||...::|:    ||||  :.:||
Human   245 IRSALGRQRLQDISSLPLPQSLKNYL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 60/210 (29%)
SOCS 240..273 CDD:295349 15/38 (39%)
SPSB4NP_543138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 5/15 (33%)
SPRY_SOCS1-2-4 54..227 CDD:293963 55/190 (29%)
SOCS 232..273 CDD:383010 15/43 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.