DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and SPSB3

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_005255730.1 Gene:SPSB3 / 90864 HGNCID:30629 Length:410 Species:Homo sapiens


Alignment Length:292 Identity:101/292 - (34%)
Similarity:150/292 - (51%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDVEVDPQQAH-PHPIAAIAPRRRRPTGRRGGVTG-------GLSSGSLDASSSTSPPPRFCPLP 58
            ||.:.||:.:. |..|.:..|           |||       |.|..|..:|..::...|.|.. 
Human    99 SDSDSDPEYSTLPPSIPSAVP-----------VTGESFCDCAGQSEASFCSSLHSAHRGRDCRC- 151

  Fly    59 NGVED---NWTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRV 120
             |.||   :|.|...::|...:|...| |.|.||..:|.|||.::|.:.|..|:|:||:.::..|
Human   152 -GEEDEYFDWVWDDLNKSSATLLSCDN-RKVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPV 214

  Fly   121 FGTSIMFGIGTKSARL--HANAFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGV 183
            :||.:|.||||....|  :.:.|.::||.:|..||||:.|:|.|:|....::.||  .|.:.|||
Human   215 YGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF--GQGSIIGV 277

  Fly   184 LFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVI 248
            ..|...|||||:|:.||:|||...|.  ::..||:||||||::.|.:..:.....:||..| ...
Human   278 HLDTWHGTLTFFKNRKCIGVAATKLQ--NKRFYPMVCSTAARSSMKVTRSCASATSLQYLC-CHR 339

  Fly   249 MRRVR--SAAQLEKLKLPLPIADYLSEVIDEK 278
            :|::|  |...||.|.||    ..|.:|:..|
Human   340 LRQLRPDSGDTLEGLPLP----PGLKQVLHNK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 71/186 (38%)
SOCS 240..273 CDD:295349 12/34 (35%)
SPSB3XP_005255730.1 SPRY_SOCS3 159..341 CDD:293936 71/187 (38%)
SOCS_SOCS_like 328..367 CDD:239687 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.