DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and SPSB2

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001139788.1 Gene:SPSB2 / 84727 HGNCID:29522 Length:263 Species:Homo sapiens


Alignment Length:271 Identity:70/271 - (25%)
Similarity:107/271 - (39%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SSSTSPPPRFCP---LPNGVED-------------NWTWSKRHRSKEVVLRGPNSRTVHFHPN-W 92
            ||||..|....|   .|.|:|:             ...|:.:..|:.:.::   ...::|... .
Human    10 SSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVK---EGGLYFERRPV 71

  Fly    93 SKGTAGVQGKRSLNNGRHYWELH--VSQRVFGTSIMFGIGTKSARLHANAFRNMLGENEHGWGLS 155
            ::.|.|.:|||..:.|.|.||:.  :.||  ||..:.|:.|..|.|..:.:..:||.|...||..
Human    72 AQSTDGARGKRGYSRGLHAWEISWPLEQR--GTHAVVGVATALAPLQTDHYAALLGSNSESWGWD 134

  Fly   156 -HKGVLWHEGV---ALLYTKRFRENQ---PTQIGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDE 213
             .:|.|:|:..   |..|....:..|   |.::.|:.|..||||.:...|..||.|||||.  ..
Human   135 IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLK--GR 197

  Fly   214 PLYPIVCSTAAKTEMTLK------------------CTRREFVNLQDRCRAVIMRRVRSAAQLEK 260
            .|||.|.:...:.::.::                  |.|.   ||.|          ....|:..
Human   198 TLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRH---NLGD----------TRLGQVSA 249

  Fly   261 LKLPLPIADYL 271
            |.||..:..||
Human   250 LPLPPAMKRYL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 55/212 (26%)
SOCS 240..273 CDD:295349 8/32 (25%)
SPSB2NP_001139788.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 9/37 (24%)
SPRY_SOCS1-2-4 46..217 CDD:293963 50/177 (28%)
SOCS_SSB2 222..263 CDD:239689 11/52 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.