DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and spsb3a

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001116480.1 Gene:spsb3a / 796171 ZFINID:ZDB-GENE-030131-4182 Length:358 Species:Danio rerio


Alignment Length:271 Identity:91/271 - (33%)
Similarity:141/271 - (52%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DPQQAHPHPIAAIAPRRRRPTGRRGGVTGGLSSGSLDASSSTSPPPRF--------CPLPNGVED 63
            |.:..:|..:.|: |.....||.        |..|.|:....|..||.        |......:|
Zfish    47 DSEAEYPAIVPAV-PSAVPVTGE--------SYCSCDSQMELSCNPRLRGYTHLRDCHCGEDDQD 102

  Fly    64 -NWTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMF 127
             :|.|.:..||...:|...| |.|.||..:|.|||.::|.|.|:.|:|:||:.::..|:||.:|.
Zfish   103 FDWVWDEGSRSSATLLSCEN-RKVSFHSEYSCGTAAIRGSRELSEGQHFWEIKMTSPVYGTDMMV 166

  Fly   128 GIGTKSARL--HANAFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEG 190
            ||||....|  :.:.|.::||::|..||||:.|:|.|.|..:.::.||  .|.:.|||..|...|
Zfish   167 GIGTSDVNLDKYRHTFCSLLGKDEDSWGLSYTGLLHHNGDKVSFSSRF--GQGSIIGVHLDTWHG 229

  Fly   191 TLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVIMRRVRSA 255
            ||||||:.||:|||  ..:..::.::|:.||||||:.|.:..:.....:||..|.:.:.:.:.|.
Zfish   230 TLTFYKNRKCIGVA--ATEMKNKHVFPMACSTAAKSSMKVIRSVSAPTSLQYLCCSRLRKLLPSG 292

  Fly   256 AQLEKLKLPLP 266
            ....:: ||||
Zfish   293 VDALRV-LPLP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 72/186 (39%)
SOCS 240..273 CDD:295349 8/27 (30%)
spsb3aNP_001116480.1 SPRY_SOCS3 104..286 CDD:293936 72/186 (39%)
SOCS 272..312 CDD:295349 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.