DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and Spsb3

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_006525228.1 Gene:Spsb3 / 79043 MGIID:1891471 Length:525 Species:Mus musculus


Alignment Length:315 Identity:99/315 - (31%)
Similarity:148/315 - (46%) Gaps:59/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDVEVDPQQAH-PHPIAAIAPRRRRPTGRRGGVTG-------GLSSGSLDASSSTSPPPRFCPLP 58
            ||.:.||:.:. |..|.:..|           |||       |.:..:...|..|:...:.|...
Mouse   190 SDSDSDPEYSSLPPSIPSAVP-----------VTGESFCDCEGQNEATFCNSLHTAHRGKDCRCG 243

  Fly    59 NGVED-NWTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFG 122
            ...|| :|.|...::|...:|...| |.|.||..:|.|||.::|.:.|.:|:|:||:.::..|:|
Mouse   244 EEDEDFDWVWDDLNKSSATLLSCDN-RKVSFHMEYSCGTAAIRGTKELGDGQHFWEIKMTSPVYG 307

  Fly   123 TSIMFGIGTKSARL--HANAFRNMLGENEHGWGLSH-------------------------KGVL 160
            |.:|.||||....|  :.:.|.::||.:|..||||:                         .|:|
Mouse   308 TDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGRCCLGHGWGWQYSRPPRITPLLLAGLL 372

  Fly   161 WHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAK 225
            .|:|....::.||  .|.:.|||..|...|||||:|:.||:|||...|.  :...||:|||||||
Mouse   373 HHKGDKTSFSSRF--GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRLQ--NRRFYPMVCSTAAK 433

  Fly   226 TEMTLKCTRREFVNLQDRCRAVIMRRVR--SAAQLEKLKLPLPIADYLSEVIDEK 278
            :.|.:..:.....:||..| ...:|::|  |...||.|.||    ..|.:|:..|
Mouse   434 SSMKVIRSCASSTSLQYLC-CYRLRQLRPNSGDTLEGLPLP----PGLKQVLHNK 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 72/211 (34%)
SOCS 240..273 CDD:295349 12/34 (35%)
Spsb3XP_006525228.1 SPRY_SOCS3 250..457 CDD:293936 72/212 (34%)
SOCS 447..483 CDD:383010 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.