DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and CG10516

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster


Alignment Length:282 Identity:92/282 - (32%)
Similarity:129/282 - (45%) Gaps:67/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PP------PRF--CPLPNGVE------------------------DNWTWSKRHRSKEVVLRGPN 82
            ||      |.|  ||.||.:|                        :.|.|.....|..||    .
  Fly     4 PPYQEACNPGFCDCPFPNSIEVTNHKGHIPDLVRCQCGEDESGNVNAWRWHATDESDAVV----T 64

  Fly    83 SRTVHFHPNWSKGTAGVQGKRSL-NNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFR--NM 144
            .|.:.|||.:|:|||.|:|:::| .|..|:||:.|...:.||.:||||||:|..|....|.  :.
  Fly    65 DRDIIFHPTYSQGTAIVRGEQALKTNMVHFWEMRVITTLAGTDVMFGIGTESVNLGQFKFHFVSA 129

  Fly   145 LGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRGL- 208
            ||.|...||.|:.|.:.|.|..|.|.::|  :|...|||..|...|.|.||.:.:.||||:..: 
  Fly   130 LGTNAQSWGFSYSGRIQHCGELLPYGQKF--SQGCLIGVCLDRTRGHLEFYLNRRSLGVAYTNVP 192

  Fly   209 DQIDEPLYPIVCSTAAKTEMTL-KCTRREFVNLQDRCRAVIMRRVRSAAQLEKLKLPLPIADYLS 272
            ...|..:||:|||||||:.:.| .||.:. |.||.|....:.|:            ||.:|:   
  Fly   193 TDPDVKIYPMVCSTAAKSVIRLINCTSQP-VTLQLRSFQALSRQ------------PLKLAE--- 241

  Fly   273 EVIDEKKPLRQVNQLEMCIMNY 294
                    |||:..|:..:.:|
  Fly   242 --------LRQMPGLKGIMQSY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 74/189 (39%)
SOCS 240..273 CDD:295349 7/32 (22%)
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 74/188 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.