DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and fbxo45

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_956889.1 Gene:fbxo45 / 393567 ZFINID:ZDB-GENE-040426-1450 Length:291 Species:Danio rerio


Alignment Length:172 Identity:54/172 - (31%)
Similarity:82/172 - (47%) Gaps:28/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLH 137
            |:.|.:: .|..|:|.:| .::.|.|.:||...:.|||.||:. .:...||..:.||.||.|.:.
Zfish   125 SRNVYIK-KNGFTLHRNP-IAQSTDGARGKIGFSEGRHAWEIW-WEGPLGTVAVIGIATKRAPMQ 186

  Fly   138 ANAFRNMLGENEHGWG-------LSHKGVLWHEGVALLYTKRFRE--NQPT-QIG----VLFDGI 188
            ...:..:||.::..||       |.|.|.:         ...|.:  |.|. |||    |:.|..
Zfish   187 CQGYVALLGSDDQSWGWNLVDNNLLHNGEV---------NGNFPQCNNAPKYQIGERIRVILDMD 242

  Fly   189 EGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTL 230
            :.||.|.:..:.||||||||.:  ..|:|.|.:....||:|:
Zfish   243 DKTLAFERGFEFLGVAFRGLPK--TCLFPAVSAVYGNTEVTM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 54/172 (31%)
SOCS 240..273 CDD:295349
fbxo45NP_956889.1 F-box-like 44..90 CDD:289689
SPRY_Fbox 117..291 CDD:293964 54/172 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.