DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and Fsn

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster


Alignment Length:171 Identity:56/171 - (32%)
Similarity:88/171 - (51%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGT 131
            ||....|:.|.:: ||..|:|.:| .::.|...:||....:|||.||: :.:...||..:.||.|
  Fly    83 WSPNDCSRNVYIK-PNGFTLHRNP-VAQSTDAARGKIGFRHGRHTWEV-IWEGPLGTVAVIGIST 144

  Fly   132 KSARLHANAFRNMLGENEHGWG-------LSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIE 189
            |.|.|..:.:..:||.::..||       |.|.|.:  :|...|.....:.....:|.|:.|..:
  Fly   145 KEAALQCHGYVALLGSDDQSWGWNLVENHLLHNGDM--QGSYPLLNNAPKYQVGERIRVILDCED 207

  Fly   190 GTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTL 230
            .||:|.|:.:.||||||||.  |:.|||.|.:....||:::
  Fly   208 NTLSFEKNYEFLGVAFRGLP--DKKLYPTVSAVYGNTEVSM 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 56/171 (33%)
SOCS 240..273 CDD:295349
FsnNP_610849.1 F-box-like 13..54 CDD:289689
SPRY_Fbox 81..255 CDD:293964 56/171 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.