DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and spsb1

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001020631.1 Gene:spsb1 / 334190 ZFINID:ZDB-GENE-030131-6122 Length:273 Species:Danio rerio


Alignment Length:267 Identity:76/267 - (28%)
Similarity:117/267 - (43%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LDASSSTSPP--PRFCPLPNGVED---NWTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQG 101
            |.|...|.|.  .....:|:..:|   ..:|:...||..:.::..|....|.|| .::.|..::|
Zfish    26 LQALDYTKPSRLDMLLDMPSASQDIQVQHSWNNDDRSLNIFVKEDNKLIFHRHP-VAQSTDAIRG 89

  Fly   102 KRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFRNMLGENEHGWGLS-HKGVLWHEGV 165
            :.....|.|.||:..:.|..||..:.|:.|..|.||:..:..::|.|...||.. .:..|:|:| 
Zfish    90 RVGYTRGLHVWEISWAMRQRGTHAVVGVATGEAPLHSVGYTALVGNNSESWGWDLGRNKLYHDG- 153

  Fly   166 ALLYTKRFRENQPTQ-----------------IGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDE 213
                     :|||::                 ..|:.|..||||:|..||:.||||||||.  .:
Zfish   154 ---------KNQPSRTYPAFLEPDETFIVPDSFLVVLDMDEGTLSFIVDGQYLGVAFRGLK--GK 207

  Fly   214 PLYPIVCSTAAKTEMTLKCTRREFVN--------LQDRCRAVIMRRVRSAAQLEKLK----LPLP 266
            .|||:|.:.....|:.::     ::|        |.|.||    |.||.|...|:|.    ||||
Zfish   208 KLYPVVSAVWGHCEIRIR-----YINGLDPEPLPLMDLCR----RSVRVALGRERLSEIHGLPLP 263

  Fly   267 --IADYL 271
              :.:||
Zfish   264 ASLKNYL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 58/210 (28%)
SOCS 240..273 CDD:295349 16/38 (42%)
spsb1NP_001020631.1 SPRY_SOCS1-2-4 54..227 CDD:293963 53/190 (28%)
SOCS_SSB1_4 232..273 CDD:239688 16/43 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.