DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and Spsb1

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001101464.1 Gene:Spsb1 / 313722 RGDID:1309319 Length:273 Species:Rattus norvegicus


Alignment Length:283 Identity:78/283 - (27%)
Similarity:119/283 - (42%) Gaps:73/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VTGGLSSGSLDASSSTSPPPR-------FC------------PLPNGVEDNWTWSKRHRSKEVVL 78
            ||||:.  ::|....|..|.:       :|            |:...|:...:|:...||..|.:
  Rat     5 VTGGIK--TVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFV 67

  Fly    79 RGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFRN 143
            :..:....|.|| .::.|..::||.....|.|.|::..:.|..||..:.|:.|..|.||:..:..
  Rat    68 KEDDKLIFHRHP-VAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTT 131

  Fly   144 MLGENEHGWGLS-HKGVLWHEGVALLYTKRFRENQPTQ-----------------IGVLFDGIEG 190
            ::|.|...||.. .:..|:|:|          :|||::                 ..|..|..:|
  Rat   132 LVGNNHESWGWDLGRNRLYHDG----------KNQPSKTYPAFLEPDETFIVPDSFLVALDMDDG 186

  Fly   191 TLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVN--------LQDRCRAV 247
            ||:|..||:.:|||||||.  .:.|||:|.:.....|:     |..:||        |.|.||  
  Rat   187 TLSFIVDGQYMGVAFRGLK--GKKLYPVVSAVWGHCEI-----RMRYVNGLDPEPLPLMDLCR-- 242

  Fly   248 IMRRVRSAAQLEKL----KLPLP 266
              |.||.|...|:|    .||||
  Rat   243 --RSVRLALGKERLGAIPALPLP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 58/210 (28%)
SOCS 240..273 CDD:295349 14/31 (45%)
Spsb1NP_001101464.1 SPRY_SOCS1-2-4 54..227 CDD:293963 52/190 (27%)
SOCS 232..273 CDD:413360 14/36 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.