DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and Spsb2

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001009660.1 Gene:Spsb2 / 297592 RGDID:1310854 Length:264 Species:Rattus norvegicus


Alignment Length:277 Identity:79/277 - (28%)
Similarity:117/277 - (42%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GRRGGVTGGLSSGSLDASSSTSPPPR------FCPLPN-GVEDNWTWSKRHRSKEV-VLRGP--- 81
            |:.....|..|:.|..|..|...||.      ..|.|: |.:.:..|:.:..|:.: |..|.   
  Rat     2 GQTALARGSSSTPSSHALYSDLSPPEGLEELLSAPPPDLGAQRHHGWNPKDCSENIDVKEGGLCF 66

  Fly    82 NSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELH--VSQRVFGTSIMFGIGTKSARLHANAFRNM 144
            ..|.|      ::.|.||:|||..:.|.|.||:.  :.||  ||..:.|:.|..|.|.|:.:..:
  Rat    67 ERRPV------AQSTDGVRGKRGYSRGLHAWEISWPLEQR--GTHAVVGVATALAPLQADHYAAL 123

  Fly   145 LGENEHGWGLS-HKGVLWHEGVAL---LYTKRFRENQ---PTQIGVLFDGIEGTLTFYKDGKCLG 202
            ||.|...||.. .:|.|:|:...|   .|....:..|   |.::.|:.|..||||.:...|..||
  Rat   124 LGSNSESWGWDIGRGKLYHQSKGLEAPQYPAGPQGEQLVVPERLLVVLDMEEGTLGYSIGGTYLG 188

  Fly   203 VAFRGLDQIDEPLYPIVCSTAAKTEMTLKC--TRR-----EFVNLQDRCRAVIMRRVRSA----- 255
            .|||||.  ...|||.|.:...:.::.::.  .||     ..::|...|       ||.|     
  Rat   189 PAFRGLK--GRTLYPSVSAVWGQCQVRIRYLGERRAEEPQSLLHLSRLC-------VRHALGDTR 244

  Fly   256 -AQLEKLKLPLPIADYL 271
             .|:..|.||..:..||
  Rat   245 LGQISSLPLPPAMKRYL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 59/204 (29%)
SOCS 240..273 CDD:295349 11/38 (29%)
Spsb2NP_001009660.1 SPRY_SOCS1-2-4 46..217 CDD:293963 55/180 (31%)
SOCS_SSB2 223..264 CDD:239689 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.