DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and spsb-2

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_497320.2 Gene:spsb-2 / 266877 WormBaseID:WBGene00021596 Length:243 Species:Caenorhabditis elegans


Alignment Length:248 Identity:63/248 - (25%)
Similarity:110/248 - (44%) Gaps:49/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SPPPRFCPLPNGVEDNWTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWE 113
            :||.|.      :::..:|:...||..::::..:..|::.|| ....|..::||...:.|.|.|:
 Worm    15 APPNRL------IQEQHSWNPDDRSPNIIVKDQDKLTLYRHP-VPNCTDCIRGKMGYSRGFHVWQ 72

  Fly   114 LHVSQRVFGTSIMFGIGTKSARLHANAFRNMLGEN--EHGWGLS----HKGVLW---------HE 163
            :...:|..||..:.|:.||:|.|.|..:..::|.|  .:||.::    |.| .|         .:
 Worm    73 IEWPERQRGTHAVVGVATKNAPLQAAEYTTLVGSNNESYGWNIATRECHYG-SWKWKYPYGNGRD 136

  Fly   164 GVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEM 228
            |.          |.|.:|..:.|..:|.|:|..|.:.|||.|:.|.  .:.|||.|.:.....|:
 Worm   137 GF----------NVPEKIYCILDMEQGNLSFATDNEYLGVVFQNLR--GKRLYPAVATLYGDCEI 189

  Fly   229 TL----KCTRREFVNLQDRCRAVIMRRVRSA------AQLEKLKLPLPIADYL 271
            |:    .....|.:.|.:.||    ||.||.      .:::.|.:|..:.:||
 Worm   190 TMTHLGSLEPVEMLPLFELCR----RRFRSIMGPDPDKRIKPLMIPPVMKEYL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 52/203 (26%)
SOCS 240..273 CDD:295349 11/38 (29%)
spsb-2NP_497320.2 SPRY_SOCS1-2-4 25..194 CDD:293963 48/182 (26%)
SOCS_SSB1_4 200..241 CDD:239688 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.