DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and spsb-1

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_497321.3 Gene:spsb-1 / 266876 WormBaseID:WBGene00021597 Length:483 Species:Caenorhabditis elegans


Alignment Length:237 Identity:60/237 - (25%)
Similarity:110/237 - (46%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PIAAIAPRRRRPTGRRGGVTGGLSSGSLDASSSTSPPPRFCPLPNGVEDNWTWSKRHRSKEVVLR 79
            |:.:::|  ..|:....|:...|.....|.....:.|.:|      :::..:|:...||..:.::
 Worm    89 PMRSLSP--AHPSAVMSGMDDFLRPDRFDRIMQMTKPDQF------IQEQHSWNPEDRSLNIFVK 145

  Fly    80 GPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFRNM 144
            ..:..|.|.|| .::.|..::||...:.|.|.|::...:|..||..:.|:.||:|.|||..:..:
 Worm   146 DEDKFTFHRHP-VAQSTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLHAAGYTAL 209

  Fly   145 LG--ENEHGWGLSHKGVLWHEGVALLYTKRF-----RE--NQPTQIGVLFDGIEGTLTFYKDGKC 200
            :|  :..:||.::.:..  |.......|.|:     |:  |.|.:...:.|..||.:.|..|.:.
 Worm   210 IGTTDESYGWDITRREC--HHDSKHTMTWRYPFSNSRDVYNVPDKFYCILDMDEGYMAFATDDEF 272

  Fly   201 LGVAFRGLDQIDEPLYPIVCSTAAKTEMTLK---CTRREFVN 239
            ||||||.|.  .:.|||||.:.....|::::   ...||.::
 Worm   273 LGVAFRNLK--GKTLYPIVAAVWGHCEISMRYLGSLERELIS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 52/188 (28%)
SOCS 240..273 CDD:295349 60/237 (25%)
spsb-1NP_497321.3 SPRY_SOCS1-2-4 131..303 CDD:293963 50/176 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.