DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and SPCC1259.12c

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_588068.2 Gene:SPCC1259.12c / 2538867 PomBaseID:SPCC1259.12c Length:491 Species:Schizosaccharomyces pombe


Alignment Length:219 Identity:51/219 - (23%)
Similarity:84/219 - (38%) Gaps:43/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PNGVEDNWTWSKRHRSKE-------VVLRGPNSRTVHFHPNWSKGTAGVQGKRSL--NNGRHYWE 113
            |..:..:|..:.:..|.|       |...||.:.|.|       ..|.|:...::  |...:|:|
pombe    68 PKAIPSSWNPNDKSDSLELMNNNMGVYFFGPEAGTEH-------DAASVKADHAIPSNTSIYYYE 125

  Fly   114 LHVSQRVFGTSIMFGIGTKSARLHANAFRNMLGENEHGWGL-SHKGVLWH---EGVALLYTKRFR 174
            :.:..|  |.....|:|.....:..|.......|:   ||. .:.|..::   .|.|  |...|.
pombe   126 IQILSR--GKEGKMGVGFCRKSMQTNRLPGCTAES---WGYHGNSGEKFNCSKTGEA--YGPEFT 183

  Fly   175 ENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVN 239
            .......||.|  |..|:.:.|:|..|||||:   ::.:.|||::...:....:.:...:..|  
pombe   184 TGDIIGCGVNF--INRTIFYTKNGAYLGVAFK---KVSDVLYPVIGLKSHGEHVEVNFGQNPF-- 241

  Fly   240 LQDRCRAVIMRRVRSAAQLEKLKL 263
            |.|         :..|.|:||.||
pombe   242 LYD---------IDYAIQMEKNKL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 44/197 (22%)
SOCS 240..273 CDD:295349 8/24 (33%)
SPCC1259.12cNP_588068.2 SPRY_RanBP9_10 102..238 CDD:293966 35/154 (23%)
LisH 274..299 CDD:285685
CTLH 308..361 CDD:128914
CLTH 309..470 CDD:287564
CRA 381..475 CDD:214806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.