DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and FBXO45

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001099043.1 Gene:FBXO45 / 200933 HGNCID:29148 Length:286 Species:Homo sapiens


Alignment Length:291 Identity:75/291 - (25%)
Similarity:108/291 - (37%) Gaps:90/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAAIAPRRRRPTG----RRGGVTGGLSSGSLDASSSTSPPPRF---------------CPLP--- 58
            :||.||.....:|    ..||...|..|||..|.:....|.|.               |.|.   
Human     1 MAAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGGRLPSRVLELVFSYLELSELRSCALVCKH 65

  Fly    59 -----NGVEDNWTW-----------------------------------SKRHRSKEVVLRGPNS 83
                 :|.|::..|                                   |....|:.|.:: .|.
Human    66 WYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIK-KNG 129

  Fly    84 RTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFRNMLGEN 148
            .|:|.:| .::.|.|.:.|...:.|||.||:. .:...||..:.||.||.|.:....:..:||.:
Human   130 FTLHRNP-IAQSTDGARTKIGFSEGRHAWEVW-WEGPLGTVAVIGIATKRAPMQCQGYVALLGSD 192

  Fly   149 EHGWG-------LSHKGVLWHEGVALLYTKRFRE--NQPT-QIG----VLFDGIEGTLTFYKDGK 199
            :..||       |.|.|.:         ...|.:  |.|. |||    |:.|..:.||.|.:..:
Human   193 DQSWGWNLVDNNLLHNGEV---------NGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYE 248

  Fly   200 CLGVAFRGLDQIDEPLYPIVCSTAAKTEMTL 230
            .||||||||.::  .|||.|.:....||:||
Human   249 FLGVAFRGLPKV--CLYPAVSAVYGNTEVTL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 57/216 (26%)
SOCS 240..273 CDD:295349
FBXO45NP_001099043.1 F-box-like 38..83 CDD:372399 7/44 (16%)
SPRY_Fbox 112..286 CDD:293964 56/180 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.