DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and madd-2

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_503395.1 Gene:madd-2 / 178619 WormBaseID:WBGene00016539 Length:765 Species:Caenorhabditis elegans


Alignment Length:251 Identity:54/251 - (21%)
Similarity:88/251 - (35%) Gaps:79/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TGRRGGVTGGLSSGSLDASSSTSPPPRFCPLPNGVEDNWTWSKRHRSKEVVLRGPNSRTVHF--- 88
            |||..|....:.||          |...|.: :|:..|..::.|.:|.........|.::..   
 Worm   538 TGRDDGNFKEVYSG----------PDTICTI-DGLHFNTVYAARVKSYNSAGESEYSESICLQTA 591

  Fly    89 HPNWSKGTAG------------------------VQGKRSLNNGRHYWELHVSQRVFGTSIMFGI 129
            |..|.:.|..                        :.|..:.:.|.||||:.:.:....:.|:.|:
 Worm   592 HVAWFQLTKSPSQRDMILSNECATLSGSSLEYRTILGSIAFSKGVHYWEVTIDRHDGNSDIVIGV 656

  Fly   130 GTKSARLHANAFRN-MLGENEHGWGLSHKGV-LWHEGVALLYTKRFRE------NQPTQIGVLFD 186
            ...:..      || |||::.|||.:...|. .|:     |:.:....      .:.|.|||..|
 Worm   657 AQPAVN------RNVMLGKDLHGWSMYVDGERSWY-----LHNETHHNRVLGGVTRGTVIGVRLD 710

  Fly   187 GIEGTLTF--------YKDGKCLGVAF----RGLDQIDEPLYPIVCSTAAKTEMTL 230
            ...||:.:        |:|.   .:||    |||      .|| ..|..|.:.:|:
 Worm   711 CDRGTMEYTVNDRKRIYQDD---SMAFTNMPRGL------YYP-AFSVNANSSITV 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 45/214 (21%)
SOCS 240..273 CDD:295349
madd-2NP_503395.1 RING 7..>33 CDD:214546
zf-B_box 271..313 CDD:279037
BBC 320..445 CDD:128778
FN3 499..590 CDD:238020 13/62 (21%)
SPRY_PRY_TRIM67_9 587..763 CDD:293947 41/191 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.