DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and LOC100497319

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_002934145.1 Gene:LOC100497319 / 100497319 -ID:- Length:255 Species:Xenopus tropicalis


Alignment Length:249 Identity:97/249 - (38%)
Similarity:133/249 - (53%) Gaps:25/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GRRGGVTGGLSSGSLDASSSTSPPPRFCPLPNGVEDNWTWSKRHRSKEVVLRGPNSRTVHFHPN- 91
            ||.|.......:.|||.     |.||.|     |...|.|....::....| .|..|.|:||.: 
 Frog     3 GRSGAPRTEPRTESLDL-----PMPRTC-----VPRRWVWDAHCQTPGTEL-SPCHRVVYFHTDP 56

  Fly    92 --WSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFR--NMLGENEHGW 152
              .|.||||::|.....:|.||||:...:...|.|:|.|:||..|.|||..|:  |:||.:...|
 Frog    57 VLESCGTAGMRGSTGFLHGEHYWEIEFLEPPSGLSVMVGVGTGRAALHAGDFQFVNLLGMDTESW 121

  Fly   153 GLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYP 217
            |||:||..||.|.:..||:.|.| :.|.|||..:..||||.||::.:.|||||.||.::..||||
 Frog   122 GLSYKGTAWHGGTSRRYTEPFYE-KGTVIGVHLNIDEGTLAFYRNRQSLGVAFTGLQKVQSPLYP 185

  Fly   218 IVCSTAAKTEMT--LKCTRREFVNLQDRCRAVIMRRVRSAAQLEKLK-LPLPIA 268
            :|.||:..||:.  |:|:  ...:||:||.:.:   ..|.||.:.:. ||||.|
 Frog   186 MVSSTSPGTELAVGLQCS--TLPSLQERCLSTL---AHSLAQKDMVDCLPLPAA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 78/191 (41%)
SOCS 240..273 CDD:295349 12/30 (40%)
LOC100497319XP_002934145.1 SPRY_SOCS3 30..217 CDD:293936 78/193 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6401
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H124681
Inparanoid 1 1.050 146 1.000 Inparanoid score I4328
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012077
OrthoInspector 1 1.000 - - oto102852
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9948
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.