DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and si:ch1073-228j22.2

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_021325532.1 Gene:si:ch1073-228j22.2 / 100334514 ZFINID:ZDB-GENE-110411-227 Length:285 Species:Danio rerio


Alignment Length:259 Identity:61/259 - (23%)
Similarity:95/259 - (36%) Gaps:67/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GLSSGSLDASS-----STSPPPRFCPL-------PNGVEDNWTWSKRHRSKEVVLRGPNSRTVHF 88
            ||......:||     |.:||.|...|       |......|:                  ..|.
Zfish    12 GLPKNRNQSSSAFTPFSVTPPIRLAVLLDTPPVAPGNPRSQWS------------------PTHL 58

  Fly    89 HPNWSKGTAGVQGKR--------------SLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHAN 139
            .||..:..:||:..|              ..:.|.|.||:....:..|:..:.|:.|..:.|.|:
Zfish    59 SPNLQRCVSGVRVHRGHVEQSSDAARAAIGTSTGLHIWEVKWEGQQRGSHALLGVSTHKSPLQAS 123

  Fly   140 AFRNMLGENEHGWG--LSHKGVLWHEGVALLYTKRFRE----------NQPTQIGVLFDGIEGTL 192
            .::.::|.:...||  || ...|||:|      |..|.          :.|.::.::.|...|||
Zfish   124 GYKALIGGDSCSWGWELS-TNQLWHDG------KEGRSYPGGGATGVLSVPDRVLLVVDADAGTL 181

  Fly   193 TFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKC---TRREFVNLQDRCRAVIMRRVR 253
            .:..|...|||||:.|.:..| |:|.|.......|:.::.   |.|:...||...|....|.:|
Zfish   182 GYVVDDCYLGVAFQDLPKGVE-LFPAVSCVWGGAEICIRYLSGTTRDAPALQALSRLSARRALR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 49/213 (23%)
SOCS 240..273 CDD:295349 5/14 (36%)
si:ch1073-228j22.2XP_021325532.1 SPRY 53..221 CDD:322017 44/193 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.