DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and si:dkey-23n7.10

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_002662894.2 Gene:si:dkey-23n7.10 / 100333689 ZFINID:ZDB-GENE-141222-64 Length:228 Species:Danio rerio


Alignment Length:222 Identity:88/222 - (39%)
Similarity:133/222 - (59%) Gaps:18/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EDNWTWSKRHRSKEV---VLRGPNSRTVHFHPN---WSKGTAGVQGKRSLNNGRHYWELHVSQRV 120
            :::|.|....:|.:.   |.|    :.|:||.:   .|:|||||:|.:...:|.||||:...:..
Zfish    10 QESWEWDPDSKSPDAHVSVCR----QAVYFHISPLLDSQGTAGVRGTKGFTHGEHYWEIEFLEPP 70

  Fly   121 FGTSIMFGIGTKSARLHA--NAFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGV 183
            :|:|:|.|:||::|.||.  ..|.|::|.:...||||:||.:||:|.:..||:.|.|.. |.|||
Zfish    71 YGSSVMVGVGTQNALLHTGDQTFVNLIGMDSESWGLSYKGYIWHKGRSRKYTEAFYERN-TVIGV 134

  Fly   184 LFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVI 248
            |.|...|||||.::|..|||||.||:|:.:.|||:|.|||.:||:.|....:...:||:.|..:|
Zfish   135 LLDLSAGTLTFSRNGVNLGVAFTGLEQVGKALYPLVSSTAPETELQLGLRSQRISSLQEHCIHII 199

  Fly   249 MRRVRSAAQLEKLK-LPLPIADYLSEV 274
               .:|.:|..:.| |||| |..|.::
Zfish   200 ---TQSLSQGRRAKGLPLP-ASLLCQI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 78/192 (41%)
SOCS 240..273 CDD:295349 13/33 (39%)
si:dkey-23n7.10XP_002662894.2 SPRY_SOCS3 13..199 CDD:293936 78/190 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595041
Domainoid 1 1.000 114 1.000 Domainoid score I6071
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H124681
Inparanoid 1 1.050 151 1.000 Inparanoid score I4325
OMA 1 1.010 - - QHG47458
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012077
OrthoInspector 1 1.000 - - oto38739
orthoMCL 1 0.900 - - OOG6_112817
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9948
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.