DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLK1 and SAK

DIOPT Version :9

Sequence 1:NP_005021.2 Gene:PLK1 / 5347 HGNCID:9077 Length:603 Species:Homo sapiens
Sequence 2:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster


Alignment Length:585 Identity:175/585 - (29%)
Similarity:268/585 - (45%) Gaps:80/585 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    59 LGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDN 123
            |||||||..::.....|.:..|.|::.|.|:.......::..|:.||..|.|..|:..:.||:|.
  Fly    20 LGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDA 84

Human   124 DFVFVVLELCRRRSLLELHKR----RKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFL 184
            ::|::||||....   |||:.    .:..||.||...|:|:|.|..|||.:.::|||:.|.||.|
  Fly    85 NYVYLVLELAHNG---ELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLL 146

Human   185 NEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKP 249
            :.::.|||.||||||:::...||..|:|||||||:|||:|:..|....||||:||::||||||:|
  Fly   147 SREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRP 211

Human   250 PFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFF----TSGY- 309
            ||||..::.|..::..:||.:|.|::..|..||.|:|:..|..|.|:..:|...|.    ..|: 
  Fly   212 PFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLKCSNGGHS 276

Human   310 IPARLPITCLTIPPRFS--IAPSSLDPSNRKPL-TVLNKGLENPLPERPREKEEPV-----VRET 366
            .|..|.:...::....|  |..:|.|..|.:.: :|.|.|.:..||: .||:.:.|     ..:|
  Fly   277 APGALNVFSQSMESGDSGIITFASSDSRNSQQIRSVENSGPQQVLPQ-IREEFKQVHHKLPYEQT 340

Human   367 GEVVDCHLSDMLQQLHSVNASKPS----ERGLVRQEE----AEDPACIPIFWVSKWVD--YSDKY 421
            |  :....|..|.:.:...|:|.|    |.|.|...:    .||...:|.....:.:.  |..|.
  Fly   341 G--LFGQASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTKRLLPTRYKTKN 403

Human   422 GLGYQLCDNSVGVLF------------NDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMK 474
            .:...|.:..|.:.|            ||..|  :.:||..:...:.|.... |.|...|..|..
  Fly   404 AIMSILRNGEVVLEFLKFRPTYNEDRINDICR--ISDDGQRIIIYQPDPGRG-LPVREQPPDLQI 465

Human   475 KITLLKY-FRNYMSEHLLK--AGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQ 536
            ......| :.|..|:|..|  .||...   |...::.|.: |:|.|.....|..:....:|.|:.
  Fly   466 PSGDCVYNYDNLPSKHWKKYIYGARFV---GLVKSKTPKV-TYFSTLGKCQLMETMTDFEIRFYS 526

Human   537 DHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGC----------------CKELASRLRYART 585
            . .||:..|......| |...       .||.:|.|                |..:::.|..|:|
  Fly   527 G-AKLLKTPSEGLKVY-DRNG-------MLLSDYSCSESRSLIEHGNECFTHCVNISNALEVAQT 582

Human   586  585
              Fly   583  582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLK1NP_005021.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
STKc_PLK1 45..309 CDD:271089 103/257 (40%)
Activation loop 194..221 16/26 (62%)
D-box that targets the protein for proteasomal degradation in anaphase 337..340 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..364 8/31 (26%)
POLO_box_1 407..494 CDD:240561 21/103 (20%)
Linker 493..507 3/13 (23%)
POLO_box_2 509..590 CDD:240560 20/93 (22%)
Important for interaction with phosphorylated proteins. /evidence=ECO:0000250 538..540 0/1 (0%)
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 102/249 (41%)
S_TKc 14..267 CDD:214567 102/249 (41%)
POLO_box_Plk4_1 382..497 CDD:240557 25/120 (21%)
POLO_box_Plk4_2 498..596 CDD:240558 20/95 (21%)
POLO_box_Plk4_3 657..738 CDD:240559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.