DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLIN1 and pqn-90

DIOPT Version :10

Sequence 1:NP_002657.3 Gene:PLIN1 / 5346 HGNCID:9076 Length:522 Species:Homo sapiens
Sequence 2:NP_502843.1 Gene:pqn-90 / 190671 WormBaseID:WBGene00004170 Length:420 Species:Caenorhabditis elegans


Alignment Length:40 Identity:13/40 - (32%)
Similarity:20/40 - (50%) Gaps:3/40 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    16 EQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVC 55
            :|:.:||   |:||.....||.|...|:.::|.|.....|
 Worm   212 QQQCLLQ---QVPVQQCYQECTQPCQTTCQQAAPQCVQQC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLIN1NP_002657.3 Perilipin 13..414 CDD:460784 13/40 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..217
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..318
Required for interaction with CIDEC. /evidence=ECO:0000250 291..319
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..522
pqn-90NP_502843.1 DUF1096 20..68 CDD:368941
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.