DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLIN1 and pqn-57

DIOPT Version :10

Sequence 1:NP_002657.3 Gene:PLIN1 / 5346 HGNCID:9076 Length:522 Species:Homo sapiens
Sequence 2:NP_001367763.1 Gene:pqn-57 / 187751 WormBaseID:WBGene00004141 Length:378 Species:Caenorhabditis elegans


Alignment Length:63 Identity:16/63 - (25%)
Similarity:22/63 - (34%) Gaps:13/63 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    34 CECFQKTYTSTKEAHPLVASVCNAYEKGVQS---ASSLAAWSMEPVVRRLSTQFTAANELACR 93
            |.|.|...|.:          |:.....||.   :.|.|.......|:..|||...|.:.:||
 Worm    37 CSCQQVQQTQS----------CSCQSAPVQQQAPSCSCAQPQQTQTVQVQSTQCAPACQQSCR 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLIN1NP_002657.3 Perilipin 13..414 CDD:460784 16/63 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..217
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..318
Required for interaction with CIDEC. /evidence=ECO:0000250 291..319
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..522
pqn-57NP_001367763.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.