DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meso18E and UTF1

DIOPT Version :9

Sequence 1:NP_001162799.1 Gene:meso18E / 53448 FlyBaseID:FBgn0040089 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_003568.2 Gene:UTF1 / 8433 HGNCID:12634 Length:341 Species:Homo sapiens


Alignment Length:262 Identity:55/262 - (20%)
Similarity:87/262 - (33%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 APRTPESYFNVPESVALLNIVKSERIQSAFQSNRKNHASVWEMVAEVLNRFSARKRTAKQCCNRY 82
            |.|||   ::..|:..||..:....:..|...:|:.....:..|:..|.:...| ||..||..||
Human    58 AQRTP---WSARETELLLGTLLQPAVWRALLLDRRQALPTYRRVSAALAQQQVR-RTPAQCRRRY 118

  Fly    83 ENLKKIYTQLKKNPERHVRRNWPYMFLFKEIEEQRGECWGSNGKRLALITKNHNELSYYQRRRQA 147
            :.||      .|..|.|.:...|:   .::|.:..| ..|.||::              :.||::
Human   119 KFLK------DKFREAHGQPPGPF---DEQIRKLMG-LLGDNGRK--------------RPRRRS 159

  Fly   148 AELGVLLNKDNLTPHQHSLLQSLSQSQSQSHSHAHSTDSSQSGSKLDRFLPNHFVEAQLSEVAGP 212
            ...|.........|:.|:  .:.|:..:.....|...|:..:.:.  ||.|:    ...|..|.|
Human   160 PGSGRPQRARRPVPNAHA--PAPSEPDATPLPTARDRDADPTWTL--RFSPS----PPKSADASP 216

  Fly   213 VGGSASGVSGMSAGGFDENPLQMQMVQAAAAAAAVAAHKRHELQMASVGGVQMTPEDDDEDEPQ- 276
            ..||.                     .|.|..|...........:...|.....|..:|.|.|. 
Human   217 APGSP---------------------PAPAPTALATCIPEDRAPVRGPGSPPPPPAREDPDSPPG 260

  Fly   277 RP 278
            ||
Human   261 RP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meso18ENP_001162799.1 Myb_DNA-bind_4 23..106 CDD:290549 19/82 (23%)
UTF1NP_003568.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 2/3 (67%)
Myb_DNA-bind_4 79..134 CDD:290549 16/61 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..273 29/160 (18%)
Leucine-zipper 279..310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.