DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meso18E and si:dkey-261j15.2

DIOPT Version :9

Sequence 1:NP_001162799.1 Gene:meso18E / 53448 FlyBaseID:FBgn0040089 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001313513.1 Gene:si:dkey-261j15.2 / 794828 ZFINID:ZDB-GENE-120215-69 Length:356 Species:Danio rerio


Alignment Length:464 Identity:90/464 - (19%)
Similarity:155/464 - (33%) Gaps:146/464 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ESVALLNIVKSERIQSAFQSNRKNHASVWEMVAEVLNRFSARKRTAKQCCNRYENLKKIYTQLKK 94
            |...||.|..|..||...:.::|......|:..|::|  ....|:::|..|:.:.|:|.|..||.
Zfish    13 EISVLLAIWSSSEIQEKLERSKKKQIVYDEISQEMMN--GGFNRSSEQIVNKLKKLRKEYRDLKM 75

  Fly    95 NPERHVRRNWPYMFLFKEIEEQRGECWGSNGKRLALITKNHNELSYYQRRRQAAELGVLLNKDNL 159
            .|.:..|                    |.:.||    |.:|..:......|.::.....||....
Zfish    76 KPSKRGR--------------------GGHNKR----TFDHGVMESILGDRPSSHFTRALNSATA 116

  Fly   160 TPHQHSLLQSLSQSQSQSHSHAHST----DSSQSGSKLDRFLPNHFVE-----AQLSEVAGPVGG 215
            |...:......|:.:..|..|.|.:    .|.::.:.|..:....|.|     .:...|...:  
Zfish   117 TVETNPESPVCSEDEIGSKVHEHKSVQQWTSKETNTLLTIWSSTEFQERLEKSKRRKRVYEDI-- 179

  Fly   216 SASGVSGMSAGGFDENPLQMQMVQAAAAAAAVAAHK----RHELQMASV----GGVQMTPEDDDE 272
                ...|...||.....|:             .:|    :.||:...:    ..:|:..:.|::
Zfish   180 ----CQEMVNAGFTRTTEQI-------------VNKIKKLKKELKDQKIEPGKSSIQLNIKTDED 227

  Fly   273 DEPQRPAFKNHLHVLGHGHGLGLGHAPMDDSGEAPDFEKDCNGALNMHHQNNNHNENHISMKSEP 337
            |        ||:       ...|.:.|.:...||      .|.|..|           :.:|:|.
Zfish   228 D--------NHM-------DNDLENLPANQLSEA------LNSASAM-----------LEIKAES 260

  Fly   338 LSEGEFNPDDIQLMQTNYNGAQNYYSPGMDANILH-PDVIVDTDILSDCSSSTTLKKKRKMSTST 401
            ||.                      :..:|..:|: |:        :..|||.||.||...|...
Zfish   261 LSS----------------------AADLDDEVLNQPE--------TSLSSSQTLIKKSLGSGRI 295

  Fly   402 DGDSTNYELIEYLKRREKR--------DEELLKRMDAREDRLMNLLERTVVAIETLAVKRALTFP 458
            ..:.:|.||::||:..::|        :..:|.:||...:.::.||.|.|..:|.          
Zfish   296 RKNDSNQELLDYLQTADERFMAHAKELNTAILNKMDEATNSMLGLLGRMVTLMEA---------- 350

  Fly   459 VNPTKENAP 467
               .:||.|
Zfish   351 ---QQENKP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meso18ENP_001162799.1 Myb_DNA-bind_4 23..106 CDD:290549 21/75 (28%)
si:dkey-261j15.2NP_001313513.1 Myb_DNA-bind_4 9..82 CDD:290549 20/70 (29%)
Myb_DNA-bind_4 144..>195 CDD:290549 8/56 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.