DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meso18E and LOC102547897

DIOPT Version :9

Sequence 1:NP_001162799.1 Gene:meso18E / 53448 FlyBaseID:FBgn0040089 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_008770124.1 Gene:LOC102547897 / 102547897 RGDID:7640129 Length:361 Species:Rattus norvegicus


Alignment Length:463 Identity:93/463 - (20%)
Similarity:152/463 - (32%) Gaps:186/463 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ESVALLNIV-KSERIQSAFQSNRKNHASVWEMVAEVLNRFSARKRTAKQCCNRYENLKKIYTQLK 93
            |:..||:|: ::|.|| ..|:...| |.|:..|::.:.:...| ||.:||.::::.||.:|.:  
  Rat    16 ETRTLLSILGEAEYIQ-RLQTVHHN-ADVYRAVSKRMQQEGFR-RTERQCRSKFKVLKAMYLK-- 75

  Fly    94 KNPERHVRRNWPYMFLFKEIEEQRGECWGSNGKRLALITKNHNELSYYQRRRQAAELGVLLNKDN 158
                                               |.:.             ||..||.      
  Rat    76 -----------------------------------ACVA-------------QATSLGG------ 86

  Fly   159 LTPH--QHSLLQSLSQSQSQSHSHAHSTDSSQSGSKLDRFLPNHFVEAQ-----------LSEVA 210
             .||  .:.:|..|.::|:       .||            |::.:||.           .|:..
  Rat    87 -PPHCPFYDILDQLLRNQT-------VTD------------PDNLMEATAWAKHCDRDLVASDKP 131

  Fly   211 GPVGGSASGVSGMSAGGFDENPLQMQMVQAAAAAAAVAAHKRHELQMASVGGVQMTPEDDDEDEP 275
            |..|.|                     ||.|....| |.|:|          |..|.::.|||..
  Rat   132 GDEGAS---------------------VQEAKRTQA-ACHRR----------VLQTVKESDEDCQ 164

  Fly   276 QRPAFKNHLHVLGHGHGLGLGHAPMDDSGEAPDFEKDCNGA------LN---MHH---------Q 322
            .|         :..|         ||::.:..|...:.:||      ||   .||         |
  Rat   165 LR---------ISDG---------MDEASDIEDSWDESSGAGCSQGTLNYSSSHHLFKGAVAPCQ 211

  Fly   323 NNNHNENHISMKSEPLSEGEFNPDDIQLMQTNYNGAQNYYSPGMDANI--LHPDVIVDTDILSDC 385
            :.......:|.:|.|.:.....|         ...|...:.||..:.:  |..:   |..::|:.
  Rat   212 SRPMTRLAVSRESSPCTSTSRIP---------LGAASTPHPPGSSSRVAFLSGE---DRPLISEP 264

  Fly   386 SSSTTLKKKRKMSTSTDGD-STNYELIEYLKRREKRDEELLKRM-------DAREDRLMNLLERT 442
            |...|.::||.::.:...: :.|..|...|..||   ||.|.|:       .|::|....|....
  Rat   265 SPRCTRQRKRSVARTIATELAENRRLARELSSRE---EEKLDRLIAIGEEASAQQDTANELRRDA 326

  Fly   443 VVAIETLA 450
            |.|:..||
  Rat   327 VTAVRRLA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meso18ENP_001162799.1 Myb_DNA-bind_4 23..106 CDD:290549 20/76 (26%)
LOC102547897XP_008770124.1 Myb_DNA-bind_4 11..94 CDD:290549 27/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.