DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and AtHB23

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:156 Identity:41/156 - (26%)
Similarity:70/156 - (44%) Gaps:18/156 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 RERLSNTMS-ANLSQSHQHHPSND--KDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLA 500
            |..::|... .||..:.....|:|  |.|:||.   ..:.:|:.||||.||....|....:.:||
plant    41 RSPMNNVQGFCNLDMNGDEEYSDDGSKMGEKKR---RLNMEQLKALEKDFELGNKLESDRKLELA 102

  Fly   501 YALGMSESQVKVWFQNRRTKWR-KRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLD----- 559
            .|||:...|:.:||||||.:.: |:...:....||:.:.:..:|     |.:.:.|:.|.     
plant   103 RALGLQPRQIAIWFQNRRARSKTKQLEKDYDMLKRQFESLRDEN-----EVLQTQNQKLQAQVMA 162

  Fly   560 -MGESPAQNKRCRSNSSGSSQQQQDN 584
             ....|.::......:.||...:.:|
plant   163 LKSREPIESINLNKETEGSCSDRSEN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 20/54 (37%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 22/55 (40%)
HALZ 126..168 CDD:396657 7/46 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.