DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and HB-3

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:253 Identity:61/253 - (24%)
Similarity:101/253 - (39%) Gaps:72/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 NSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHI 417
            |:...|:|    |.|...||....|     |.|....:.:.:..|::.:...:|.:|..|:..:.
plant    38 NAHHLPSP----TSLPSCPPHLFYG-----GGGNYMMNRSMSFTGVSDHHHLTQKSPTTTNNMND 93

  Fly   418 VDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALE 482
            .|:.     |.:.                  |||....|....:|  ||:     .:.:|:.|||
plant    94 QDQV-----GEED------------------NLSDDGSHMMLGEK--KKR-----LNLEQVRALE 128

  Fly   483 KTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDC 547
            |:||....|....:.:||.|||:...|:.:||||||.:|:.:.......:.:||.|:        
plant   129 KSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYDSLKKQFDV-------- 185

  Fly   548 SETMDSDNESL-----------------DMGESPAQNKR----CRSNSSGSSQQQQDN 584
               :.|||:||                 |..|| |:.||    ...:::||::...:|
plant   186 ---LKSDNDSLLAHNKKLHAELVALKKHDRKES-AKIKREFAEASWSNNGSTENNHNN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 10/34 (29%)
Homeobox 469..523 CDD:395001 21/53 (40%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 23/59 (39%)
HALZ 170..208 CDD:280364 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.