DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and HAT14

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_196289.2 Gene:HAT14 / 830560 AraportID:AT5G06710 Length:336 Species:Arabidopsis thaliana


Alignment Length:423 Identity:80/423 - (18%)
Similarity:113/423 - (26%) Gaps:183/423 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 NNNNNNNNNSSNNNNSSPL---MLLKAAHGG--GLKDSDSPSTTPPPASSRLHSDSSPSPRYEHN 203
            |:..||.:.||.:.:...|   |.|..|.||  .|..|.|||..        .....|:||    
plant    21 NSKINNPSVSSTSTSEKDLGFCMALDVAFGGHRSLSSSSSPSVE--------DEKKKPAPR---- 73

  Fly   204 SSPGVDSAKSYALSQRSSGAEDPCQTSESASPPPQGQ---NDYSPENLSSQRAKFQHHHGVNPLA 265
                   ||.          .|..:.|.|..||.|.|   .::.|||...::.      |..|| 
plant    74 -------AKK----------SDEFRVSSSVDPPLQLQLHFPNWLPENSKGRQG------GRMPL- 114

  Fly   266 LHNANHAGNPGCHNNNNHMDHKLPLSFLGPPLAALHSMTTEMKGQGVGGSSASANGLSYSHSPNS 330
                   |...........:..:|...:.||.:...|...:...:..|          |....|.
plant   115 -------GAATVVEEEEEEEEAVPSMSVSPPDSVTSSFQLDFGIKSYG----------YERRSNK 162

  Fly   331 HLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAA 395
            ..|.|.....:|.:|:....:.|                                          
plant   163 RDIDDEVERSASRASNEDNDDEN------------------------------------------ 185

  Fly   396 AGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSN 460
                       |:..|                           :.|||...||.|..|.:.|   
plant   186 -----------GSTRK---------------------------KLRLSKDQSAFLEDSFKEH--- 209

  Fly   461 DKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRH 525
                      .|.:.:|..||.|                  .|.:...||:|||||||       
plant   210 ----------STLNPKQKIALAK------------------QLNLRPRQVEVWFQNRR------- 239

  Fly   526 AAEMATAKRKQDDMGGDNDGDCSETMDSDNESL 558
                |..|.||.::..:....|.|::..:|..|
plant   240 ----ARTKLKQTEVDCEYLKRCCESLTEENRRL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 33/211 (16%)
Homeobox 469..523 CDD:395001 15/53 (28%)
HAT14NP_196289.2 HOX 187..243 CDD:197696 25/124 (20%)
HALZ 245..288 CDD:128634 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.