DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and HAT22

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:254 Identity:55/254 - (21%)
Similarity:86/254 - (33%) Gaps:79/254 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 GLSYSHSPN--SHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSA--- 380
            ||..|.:||  :|.|        ..||||               :|....:..|..:..||.   
plant    14 GLGLSPTPNNYNHAI--------KKSSST---------------VDHRFIRLDPSLTLSLSGESY 55

  Fly   381 --LTGAGI---------PRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVAN 434
              .||||.         ....|::.::|..:...:..|...:..|....:|              
plant    56 KIKTGAGAGDQICRQTSSHSGISSFSSGRVKREREISGGDGEEEAEETTER-------------- 106

  Fly   435 PIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKL 499
                      .:.:.:|..|     :|::|.....:...:.||...||..|:....|...::..|
plant   107 ----------VVCSRVSDDH-----DDEEGVSARKKLRLTKQQSALLEDNFKLHSTLNPKQKQAL 156

  Fly   500 AYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESL 558
            |..|.:...||:|||||||           |..|.||.::..:....|.||:..:|..|
plant   157 ARQLNLRPRQVEVWFQNRR-----------ARTKLKQTEVDCEFLKKCCETLTDENRRL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 19/82 (23%)
Homeobox 469..523 CDD:395001 18/53 (34%)
HAT22NP_195493.1 Homeobox 129..179 CDD:278475 19/60 (32%)
HALZ 181..224 CDD:128634 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.