DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and HB-2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:253 Identity:54/253 - (21%)
Similarity:86/253 - (33%) Gaps:89/253 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 SASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSA 380
            |:|:.||....|.|....|...:..||...:.|..          .|||  :::||         
plant    34 SSSSFGLFRRSSWNESFTSSVPNSDSSQKETRTFI----------RGID--VNRPP--------- 77

  Fly   381 LTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNT 445
                            ..|:|..:..|                        |::|       ::|
plant    78 ----------------STAEYGDEDAG------------------------VSSP-------NST 95

  Fly   446 MSANLSQSHQHHP----------SNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLA 500
            :|::..:..:...          |:|:||.....:...|..|...||:||:....|...::..||
plant    96 VSSSTGKRSEREEDTDPQGSRGISDDEDGDNSRKKLRLSKDQSAILEETFKDHSTLNPKQKQALA 160

  Fly   501 YALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESL 558
            ..||:...||:|||||||           |..|.||.::..:....|.|.:..:|..|
plant   161 KQLGLRARQVEVWFQNRR-----------ARTKLKQTEVDCEFLRRCCENLTEENRRL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 15/71 (21%)
Homeobox 469..523 CDD:395001 20/53 (38%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:282474 22/140 (16%)
HOX 128..182 CDD:197696 21/64 (33%)
HALZ 184..227 CDD:128634 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.