DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and HB20

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:237 Identity:66/237 - (27%)
Similarity:96/237 - (40%) Gaps:58/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 PVTSAGLSALTGAGIPRFSIAAAAAG-MAQYL----SQSQGAPLKTHAGHIVDRTHLYWPGLQGL 431
            |.|.|||         |..:|....| |.|.|    ||.|   |.:...|:.:....|.......
plant     6 PTTEAGL---------RLEMAFPQHGFMFQQLHEDNSQDQ---LPSCPPHLFNGGGNYMMNRSMS 58

  Fly   432 VANPIAWRERLSNTM-SANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPE 495
            :.|.   :|..:.|: ..|||....|....:|  ||:     ...:|:.||||:||....|....
plant    59 LMNV---QEDHNQTLDEENLSDDGAHTMLGEK--KKR-----LQLEQVKALEKSFELGNKLEPER 113

  Fly   496 RAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESL-- 558
            :.:||.||||...|:.:||||||.:|:.|.......:.:||           .|::.|||.||  
plant   114 KIQLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQ-----------FESLKSDNASLLA 167

  Fly   559 ----DMGESPA-QNKRCRS------------NSSGSSQQQQD 583
                .:.|..| :||.|..            :::||::...|
plant   168 YNKKLLAEVMALKNKECNEGNIVKREAEASWSNNGSTENSSD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 5/15 (33%)
Homeobox 469..523 CDD:395001 22/53 (42%)
HB20NP_186771.1 HOX 87..140 CDD:197696 24/59 (41%)
HALZ 142..183 CDD:280364 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.