Sequence 1: | NP_001368954.1 | Gene: | HGTX / 53446 | FlyBaseID: | FBgn0040318 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_186796.1 | Gene: | HB-1 / 821138 | AraportID: | AT3G01470 | Length: | 272 | Species: | Arabidopsis thaliana |
Alignment Length: | 197 | Identity: | 49/197 - (24%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 55/197 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 434 NPIAWRERLSNTMSANLSQSHQHHP-------------SNDKDGKKKHTRPTFSGQQIFALEKTF 485
Fly 486 EQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWR-KRHAAEMATAKRKQDDMGGDNDGDCSE 549
Fly 550 TMDSD---------NESLD---------MGESPAQNK---------------RCRSNSSGSSQQQ 581
Fly 582 QD 583 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HGTX | NP_001368954.1 | ROM1 | 179..>388 | CDD:227709 | |
Homeobox | 469..523 | CDD:395001 | 22/54 (41%) | ||
HB-1 | NP_186796.1 | HOX | 66..121 | CDD:197696 | 23/57 (40%) |
HALZ | 123..165 | CDD:396657 | 9/44 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I4196 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |