DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and HAT9

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_179865.1 Gene:HAT9 / 816811 AraportID:AT2G22800 Length:274 Species:Arabidopsis thaliana


Alignment Length:172 Identity:41/172 - (23%)
Similarity:70/172 - (40%) Gaps:28/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 AGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSA 448
            :|.|..::...|..:.:..|...|.. ...:|.:|.|..      .|...:|  ..|.::..:  
plant    45 SGDPSVTVVTGADQLCRQTSSHSGVS-SFSSGRVVKRER------DGGEESP--EEEEMTERV-- 98

  Fly   449 NLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVW 513
             :|..|:     |::|.....:...:.||...||::|:....|...::..||..|.:...||:||
plant    99 -ISDYHE-----DEEGISARKKLRLTKQQSALLEESFKDHSTLNPKQKQVLARQLNLRPRQVEVW 157

  Fly   514 FQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDN 555
            |||||           |..|.||.::..:....|.||:..:|
plant   158 FQNRR-----------ARTKLKQTEVDCEFLKKCCETLADEN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 1/3 (33%)
Homeobox 469..523 CDD:395001 18/53 (34%)
HAT9NP_179865.1 HOX 112..166 CDD:197696 19/64 (30%)
HALZ 168..211 CDD:128634 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.