DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and HB6

DIOPT Version :10

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:121 Identity:40/121 - (33%)
Similarity:59/121 - (48%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWR-KRHAAE 528
            ||:.    .|..|:.||||.||....|....:.|||..||:...||.|||||||.:|: |:...:
plant    62 KKRR----LSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKD 122

  Fly   529 MATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESPAQNKRCRSNSSGSSQQQQDN 584
            ....|.:.|.:..:.|     ::..|||||....|..:.|   .|..|..:::::|
plant   123 YGVLKTQYDSLRHNFD-----SLRRDNESLLQEISKLKTK---LNGGGGEEEEEEN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeodomain 465..523 CDD:459649 26/58 (45%)
HB6NP_565536.1 Homeodomain 62..115 CDD:459649 25/56 (45%)
HALZ 117..158 CDD:460477 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.