DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and HB21

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_179445.1 Gene:HB21 / 816370 AraportID:AT2G18550 Length:220 Species:Arabidopsis thaliana


Alignment Length:115 Identity:35/115 - (30%)
Similarity:54/115 - (46%) Gaps:16/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 HLYWPGL--QGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDG---KKKHTRPTFSGQQIFAL 481
            ::|.|.:  ||..|.|...|:|.|.::..      .....|:.:|   |:|     .|.:|:..|
plant    20 NVYTPLVPQQGGEAKPTRRRKRKSKSVVV------AEEGENEGNGWFRKRK-----LSDEQVRML 73

  Fly   482 EKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMAT 531
            |.:||....|....:.:||..||:...||.|||||||.:|:.:...:..|
plant    74 EISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYT 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 21/53 (40%)
HB21NP_179445.1 HOX 61..114 CDD:197696 22/57 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.