DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and cdx4

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571184.2 Gene:cdx4 / 798281 ZFINID:ZDB-GENE-980526-330 Length:270 Species:Danio rerio


Alignment Length:265 Identity:69/265 - (26%)
Similarity:104/265 - (39%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 YSHSPN--SHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVT--SAGLSALTGA 384
            |.|.||  :|..| .|:.|:...:........|.|.||........|.|.||:  |...:.:.|.
Zfish    43 YHHVPNMETHAQS-AGAWGAPYGAPREDWGAYSLGPPNSISAPMSNSSPGPVSYCSPDYNTMHGP 106

  Fly   385 GIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSAN 449
            |      :|......:.:..:|.:|.:       :|.:.|            .|   :|.|:.::
Zfish   107 G------SAVLPPPPENIPVAQLSPER-------ERRNSY------------QW---MSKTVQSS 143

  Fly   450 LSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWF 514
                     |..|...|:..|..::..|...|||.|...:|:....:::||..||:||.|||:||
Zfish   144 ---------STGKTRTKEKYRVVYTDHQRLELEKEFHFNRYITIRRKSELAVNLGLSERQVKIWF 199

  Fly   515 QNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESPAQNKRCRSNSSGSSQ 579
            ||||.|.||       ..|:|.    |.:||. ..::.||..|  :...|.......|:..||..
Zfish   200 QNRRAKERK-------LIKKKL----GQSDGS-GGSVHSDPGS--VSPLPVPGSLSPSDIHGSLY 250

  Fly   580 QQQDN 584
            ..|.|
Zfish   251 PAQMN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 19/67 (28%)
Homeobox 469..523 CDD:395001 23/53 (43%)
cdx4NP_571184.2 Caudal_act 15..138 CDD:282574 25/123 (20%)
Homeobox 155..207 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.