DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Obox1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_082078.1 Gene:Obox1 / 71468 MGIID:1918718 Length:204 Species:Mus musculus


Alignment Length:151 Identity:32/151 - (21%)
Similarity:65/151 - (43%) Gaps:38/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 SNTMSA------NLSQSHQHHPS-------------NDKDG-----KKKHTRPTFSGQQIFALEK 483
            |.|.|:      ||.:.....||             |.:.|     |.:..|..::.:|...|:|
Mouse    47 STTKSSLSVPERNLLKQESQGPSRQSGCMLLSDKYVNKQTGPMASRKFRKERTVYTKEQQGLLQK 111

  Fly   484 TFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK------------RHAAEMATAKRKQ 536
            .|::.:|....:..:||.::|:::.::|:||:|.|.|:|:            .:.:..|.::...
Mouse   112 HFDECQYPNKKKIVELALSVGVTKREIKIWFKNNRAKYRRMNLQNIEQVLPESNGSSKAVSESTH 176

  Fly   537 DDMGGDNDGD--CSETMDSDN 555
            ..:...::|:  ||.|...|:
Mouse   177 FPVVASDNGESMCSGTFGEDS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 15/53 (28%)
Obox1NP_082078.1 homeodomain 95..153 CDD:238039 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.