DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx1-1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_035450.1 Gene:Nkx1-1 / 672284 MGIID:109346 Length:440 Species:Mus musculus


Alignment Length:415 Identity:103/415 - (24%)
Similarity:148/415 - (35%) Gaps:96/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 GGLKDSDSPSTTPPPASSRLHSDSSPSPRYEHNSSPGVDSAKSYALSQRSSGAEDPCQTSESASP 235
            |.....|.|:..|||          |.|    .|.|...:..:.|.......||.|  ....|..
Mouse     5 GPAAPGDVPALPPPP----------PGP----GSGPAPPAPAATARDTMDGRAELP--IFPRAGV 53

  Fly   236 PPQGQND---YSPENLSSQRAKFQHHHGVNPLALHNANHAGNPGCHNNNNHMDHKLPLSFLGP-- 295
            ||...:|   ..||...:.|          |.|.............:.|.....:.....|||  
Mouse    54 PPLAASDTVPAVPEGAGAAR----------PAAPPRPTSFSVLDILDPNKFNSRRRRCVLLGPVV 108

  Fly   296 ---------------PLAALHSMTTEMKGQGVGGSS--ASANGLSYSHSPNSHLISDRGSGGSSS 343
                           |.|:..|...|::.:.:..::  |:|.|...:.:.:|:...:..:.|.||
Mouse   109 PATCAPCAPAACVAVPAASGRSPRAELERRALSAATGVAAAAGAEPTSAGDSYRADEAEANGYSS 173

  Fly   344 SSSTTTTNTNSQGAPN-------PHGIDTILSKPPPVTSAGLSALTGAGIPRFSIA-------AA 394
            .|..:.|..:...||.       |...|...::.|...|.||.| .|:|.|..:..       .|
Mouse   174 GSGRSPTADSEDEAPEDEDEEEAPEVQDAQGTEEPRGGSGGLGA-RGSGCPGAAEVEASPVDDTA 237

  Fly   395 AAGMAQYLSQSQGAP----LKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQ 455
            |.|..   ..|.|||    ..|.||......       ||........|:|..            
Mouse   238 APGPR---GNSPGAPGPPATATGAGSAGSTP-------QGAAVTTKPKRKRTG------------ 280

  Fly   456 HHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTK 520
               |:.|.||.:..|..|:.:|:.|||..|:.|:||:..||..||.:|.::|:|||:||||||||
Mouse   281 ---SDSKSGKPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNRRTK 342

  Fly   521 WRKRHAAEMATAKRKQDDMGGDNDG 545
            |:|::.....:|...    ||...|
Mouse   343 WKKQNPGADTSAPTG----GGGGPG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 49/237 (21%)
Homeobox 469..523 CDD:395001 28/53 (53%)
Nkx1-1NP_035450.1 Homeobox 292..344 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.