DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Cdx2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_076453.1 Gene:Cdx2 / 66019 RGDID:621234 Length:310 Species:Rattus norvegicus


Alignment Length:377 Identity:76/377 - (20%)
Similarity:122/377 - (32%) Gaps:150/377 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 HGGGLKDSDSPSTTPPPASSRLHSDSSPSPRYEHNSSPGVDSAKSYALSQRSSGAEDPCQTSESA 233
            |.|||..:.....:|              |:|.......|.:|.:.|.:..|:.:..|...:...
  Rat    20 HSGGLNLAPQNFVSP--------------PQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPTAYG 70

  Fly   234 SPPPQGQNDYSPENLSSQRAKFQHHHGVNPLALHNANHAGNPGCHNNNNHMDHKLPLSFLGPPLA 298
            :|..:..|.|:|...::..|.   .||:|                                    
  Rat    71 APLREDWNGYAPGGAAAANAV---AHGLN------------------------------------ 96

  Fly   299 ALHSMTTEMKGQGVGGSSASANGLS-----YSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAP 358
                          |||.|:|.|.|     ::|....|......:..|.:|....|.|      |
  Rat    97 --------------GGSPAAAMGYSSPAEYHAHHHPHHHPHHPAAAPSCASGLLQTLN------P 141

  Fly   359 NPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQ----SQGAPLKTHAGHIVD 419
            .|         |.|..:|....|:.:|..|        .:.:::.:    |.|:.:||       
  Rat   142 GP---------PGPAATAAAEQLSPSGQRR--------NLCEWMRKPAQPSLGSQVKT------- 182

  Fly   420 RTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKT 484
            ||                                           |.|: |..::..|...|||.
  Rat   183 RT-------------------------------------------KDKY-RVVYTDHQRLELEKE 203

  Fly   485 FEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQ 536
            |..::|:....:|:||..||:||.|||:||||||.|.||.:..::...:::|
  Rat   204 FHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 36/213 (17%)
Homeobox 469..523 CDD:395001 24/53 (45%)
Cdx2NP_076453.1 Caudal_act 13..170 CDD:282574 41/239 (17%)
Homeobox 189..241 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.