DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Vax1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_072158.1 Gene:Vax1 / 64571 RGDID:621132 Length:336 Species:Rattus norvegicus


Alignment Length:124 Identity:43/124 - (34%)
Similarity:65/124 - (52%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEM 529
            :.|.||.:|:.:|::.||..|::.:|:.|.||.:||..|.:||:||||||||||||.:|      
  Rat    99 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK------ 157

  Fly   530 ATAKRKQDDMGGDND--GDCSETMDSDN--ESLDMGE------SPAQNKRCRSNSSGSS 578
                    |.|.|::  ...|||..:.:  ..|:.|.      .||....|.:.:.||:
  Rat   158 --------DQGKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATGALGSA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 28/53 (53%)
Vax1NP_072158.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..69
vax upstream domain 72..99 43/124 (35%)
homeobox 100..159 30/72 (42%)
Homeobox 103..156 CDD:278475 28/52 (54%)
vax downstream domain 178..189 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..267
vax terminal domain 315..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.