DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and nkx2.4a

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001104636.1 Gene:nkx2.4a / 562300 ZFINID:ZDB-GENE-030131-6336 Length:345 Species:Danio rerio


Alignment Length:276 Identity:70/276 - (25%)
Similarity:105/276 - (38%) Gaps:62/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 PHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAA------AAAGMAQYLSQSQGAPLKT--HAGH 416
            |..:..||| |...|....|.:...|.....:.|      :..||.|: |....|.:.|  |..|
Zfish    10 PFSVTDILS-PIEETYKKFSGMESTGNLTSPLGAYRQPQVSQTGMQQH-SMGHNATVATTYHMPH 72

  Fly   417 IVDR-THLYWPG-LQGLVAN----PIAWRERLSNTMSAN-----------LSQSHQHHPSNDKD- 463
            .|.: :|....| ..|.:||    | :::|.:.|:.:|.           .:.|....||...: 
Zfish    73 SVSQFSHSAMGGYCNGSIANMGDLP-SYQETMRNSAAATGWYGANPDPRYSTISRFMGPSTGMNM 136

  Fly   464 ---------------------GKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSE 507
                                 ..::..|..||..|:..||:.|:|.|||:.|||..||..:.::.
Zfish   137 TGMGTLTGMADTTKSIPPLHAAPRRKRRVLFSQAQVCELERRFKQQKYLSAPEREHLASMIHLTP 201

  Fly   508 SQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNE----SLDMGESPAQNK 568
            :|||:||||.|.| .||.|.:.|..:.:|       :|:..:...|...    .|.....|.||.
Zfish   202 TQVKIWFQNHRYK-MKRQAKDKAAQQLQQ-------EGNLCQQQQSPRRVAVPVLVKDGKPCQNG 258

  Fly   569 RCRSNSSGSSQQQQDN 584
            ......:....|||.|
Zfish   259 SNTPTPNQQQMQQQQN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 8/27 (30%)
Homeobox 469..523 CDD:395001 25/53 (47%)
nkx2.4aNP_001104636.1 Homeobox 163..216 CDD:278475 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.