DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and otx2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_012823826.1 Gene:otx2 / 548931 XenbaseID:XB-GENE-485220 Length:306 Species:Xenopus tropicalis


Alignment Length:211 Identity:51/211 - (24%)
Similarity:78/211 - (36%) Gaps:73/211 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 KPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVA 433
            |.||....|||..|             :|| ..|..|.|.|:..|                    
 Frog     6 KQPPYAVNGLSLTT-------------SGM-DLLHPSVGYPVALH-------------------- 36

  Fly   434 NPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPE--- 495
                        .|..::.|.....:..:  |::..|.||:..|:..||..|.:|:|   |:   
 Frog    37 ------------QSRQITCSFYDFAATPR--KQRRERTTFTRAQLDVLEALFAKTRY---PDIFM 84

  Fly   496 RAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDM 560
            |.::|..:.:.||:|:|||:|||.|.|:         :::|...||.|....|:..         
 Frog    85 REEVALKINLPESRVQVWFKNRRAKCRQ---------QQQQQQNGGQNKVRPSKKK--------- 131

  Fly   561 GESPAQNKRCRSNSSG 576
             .|||:.....|.:||
 Frog   132 -PSPAREVSSESGTSG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 7/18 (39%)
Homeobox 469..523 CDD:395001 22/56 (39%)
otx2XP_012823826.1 Homeobox 59..111 CDD:365835 22/54 (41%)
TF_Otx 170..251 CDD:367546
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.