DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Noto

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001178943.1 Gene:Noto / 502857 RGDID:1562910 Length:245 Species:Rattus norvegicus


Alignment Length:182 Identity:53/182 - (29%)
Similarity:78/182 - (42%) Gaps:35/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 IDTILSKPP----PVTSAGLSALTGAGIPRFS-------IAAAAAGMAQYLSQSQGAPLKTHAGH 416
            ::.||::|.    ..||..||..|.......|       :.:....:..|||.............
  Rat    46 VEAILARPETREHSATSLPLSTCTSLNFGSVSQYQVLPWVCSTGTWLPTYLSVGIYPMCSMSCMP 110

  Fly   417 IVDRTHLYWPGLQGL---------VANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPT 472
            .::.|||:..  |||         ...|      |....:.|| |.|      :.:..:|..|..
  Rat   111 GLNVTHLFCQ--QGLRLTGSELPSCLGP------LKRAPTVNL-QDH------NTERHQKRVRTM 160

  Fly   473 FSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKR 524
            ||.||:..|||.|.:...|.|.|||:||..|.::|:||::||||||.|::|:
  Rat   161 FSEQQLGELEKVFAKQHNLVGKERAQLAARLHLTENQVRIWFQNRRVKYQKQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 8/28 (29%)
Homeobox 469..523 CDD:395001 27/53 (51%)
NotoNP_001178943.1 Homeobox 158..209 CDD:278475 26/50 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.